PNC-27 – Aliquot, 5mg
Data Sheet
| Application | Binds to HDM-2 |
| CAS | 1159861-00-3 |
| Molar Mass | 4031.72 g/mol |
| Chemical Formula | C188H293N53O44S |
| Amino Acid Sequence | PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG |
| Synonyms | PNC-27, PNC27 |
| Storage | Store at ≤4°C, tightly sealed, away from heat, light and moisture. |
| Solubility | Soluble in BAC Water |
| Organoleptic Profile | White crystalline powder in 3mL glass aliquot |
| Composition | Each aliquot contains PNC-27, Acetate |
| Specification | PNC-27 content (per aliquot): PNC-27 5mg ±10% |
| Terms | This material is sold for laboratory research use only. Terms of sale apply. Not for human consumption, nor medical, veterinary, or household uses. Please familiarize yourself with our Terms & Conditions prior to ordering. |
Synthetic Anticancer Research Peptide for Cellular Targeting Studies
PNC-27 is a research-grade synthetic peptide widely studied for its potential relevance in targeted cellular signaling, membrane-associated cancer biology research, peptide-oncology investigations, and apoptotic pathway models. As an investigational peptide of interest in molecular oncology science, PNC-27 has attracted significant scientific attention in studies involving tumor-cell targeting mechanisms, membrane receptor interactions, and peptide-mediated cytotoxic research.
Researchers have investigated PNC-27 in models involving selective cellular targeting pathways, p53-associated signaling research, membrane-disruption mechanisms, and cancer biology investigations. Its investigational profile has made it a notable compound in advanced peptide research science.
Supplied as a laboratory-grade aliquot for analytical and research applications.
Common Research Areas
- Cellular Targeting Research
- Peptide Oncology Studies
- Membrane Signaling Investigation
- Apoptotic Pathway Models
- Advanced Molecular Research
How PNC-27 Works
PNC-27 has been studied for its potential interaction with pathways associated with selective cellular targeting, membrane-associated signaling, and peptide-mediated cytotoxic mechanisms. Researchers have explored its relevance in models involving p53-associated pathways, tumor-cell signaling, and molecular targeting research.
Its targeted peptide profile has made it a recurring subject in advanced oncology research.
Research Overview
PNC-27 has been investigated across a range of research models involving cellular signaling, cancer biology, and peptide-mediated targeting pathways.
Areas of scientific interest include:
- Cellular targeting pathway studies
- Membrane signaling investigations
- Oncology research models
- Apoptotic mechanism studies
- Molecular pathway research
Its broad research relevance continues to make it a notable compound in peptide science.
PNC-27 vs Related Compounds
PNC-27 vs P21
PNC-27 is often researched in peptide-oncology targeting models, while P21 is commonly investigated in neurogenic peptide research.
PNC-27 vs LL-37
LL-37 has drawn interest in antimicrobial and immune signaling investigations, whereas PNC-27 is more strongly associated with cellular targeting research.
Frequently Asked Questions
What is PNC-27 studied for?
It is commonly researched in cellular targeting, peptide oncology, membrane signaling, and apoptotic pathway models.
What type of compound is PNC-27?
PNC-27 is classified as a synthetic research peptide investigated in molecular oncology science.
How should PNC-27 be stored?
Lyophilized peptide aliquots are generally stored refrigerated according to laboratory handling protocols.
