LL-37 – Aliquot
Data Sheet
| Application | Agonist of formyl peptide receptor like-1 (FPRL-1), purinergic receptor P2X7, epidermal growth factor receptor (EGFR) and insulin-like growth factor-1 receptor (IGF-1R) |
| CAS | 154947-66-7 |
| Molar Mass | 4493 g/mol |
| Chemical Formula | C205H340N60O53 |
| Amino Acid Sequence | [LL-37, 37 aa] |
| Synonyms | CAMP, IPR001894, CAP-18, CAP18, CRAMP, HSD26, gene FALL39, gene LL37, FALL39, LL37, FALL-39, cathelicidin antimicrobial peptide, Cathelicidins, Cathelicidin, LL-37, 154947-66-7, Ropocamptide, Bac4, All38 peptide, Cathelicidin LL 37, LL-37 (Human), hCAP 18, UNII-3DD771JO2H, LL-37 trifluoroacetate salt, LL-37/hCAP18, 3DD771JO2H, CHEMBL530345, LL 37, Cathelicidin antimicrobial peptide 18, AKOS024458536 |
| Storage | Store in refrigerator at 4°C, tightly sealed, away from heat, light and moisture |
| Solubility | Soluble in BAC water |
| Organoleptic Profile | Solid, white powder in 3mL glass aliquot |
| Composition | Each aliquot contains LL-37 |
| Specification | LL-37 content for each variant (per aliquot): LL-37 6mg ±10% |
| Terms | This material is sold for laboratory research use only. Terms of sale apply. Not for human consumption, nor medical, veterinary, or household uses. Please familiarize yourself with our Terms & Conditions prior to ordering. |
Cathelicidin Host Defense Peptide for Research Use
LL-37 is a research-grade synthetic cathelicidin-derived peptide widely studied for its potential relevance in innate immune signaling, antimicrobial peptide pathways, tissue repair mechanisms, and inflammatory modulation research. As the only human cathelicidin antimicrobial peptide identified to date, LL-37 has attracted substantial scientific interest in models involving host defense signaling, epithelial integrity, regenerative biology, and immunological pathway investigation.
Researchers have investigated LL-37 in studies involving immune modulation, wound-healing signaling, biofilm-related research, inflammatory response pathways, and barrier function models. Its multifunctional biological profile has made LL-37 a notable compound in both regenerative and immune-related peptide research.
Supplied as a laboratory-grade aliquot for analytical and research applications.
Common Research Areas
- Innate Immune Signaling Research
- Host Defense Peptide Studies
- Tissue Repair and Regenerative Models
- Inflammatory Modulation Investigation
- Barrier Function and Epithelial Research
How LL-37 Works
LL-37 has been studied for its potential interaction with pathways involved in innate immune defense, inflammatory signaling, microbial response mechanisms, and tissue repair processes. Researchers have explored its relevance in models involving chemotactic signaling, epithelial barrier regulation, and regenerative immune responses.
Its broad functional profile has made LL-37 a recurring subject in advanced peptide and immunological research.
Research Overview
LL-37 has been investigated across a wide range of research models involving host defense biology, immune signaling, and regenerative pathway studies.
Areas of scientific interest include:
- Innate immune pathway studies
- Antimicrobial peptide signaling investigations
- Inflammatory modulation research
- Barrier integrity and epithelial models
- Regenerative and wound-healing pathway research
Its diverse biological relevance continues to make it a significant compound in peptide science.
LL-37 vs Related Compounds
LL-37 vs BPC-157
LL-37 is often researched in host defense and immune-regulatory models, while BPC-157 is frequently investigated in tissue repair and protective signaling pathways.
LL-37 vs KPV
KPV is commonly studied in anti-inflammatory signaling research, whereas LL-37 has broader relevance in innate immune and barrier-function investigations.
Frequently Asked Questions
What is LL-37 studied for?
It is commonly researched in innate immune signaling, host defense pathways, inflammatory modulation, and regenerative models.
What type of peptide is LL-37?
LL-37 is classified as a cathelicidin host defense peptide.
How should LL-37 be stored?
Lyophilized peptide aliquots are generally stored refrigerated according to laboratory handling protocols.
